Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowermeadowtropicalinsects
Chrysanthemum 1 from Perennial
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Black Elderberry from Elderberry
Iris Motif from Iris
Orchid Lycaste Aromatica from Orchid
Iris Flower Blossom from Iris
Double Delight Hybrid Tea Rose from Roses
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Disa Kewensis Orchid from Orchid
Steampunk Bee from Steampunk animals coloring book
Bee from Cartoon animals v coloring book
Apple Blossom Branch from Apple tree
Bumblebee from Woodland animals
Daffodil from Daffodil
Butterfly from Cartoon animals viii coloring book
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Cosmos Scabiosoides from Cosmos
Swallow Tail Hummingbird from Hummingbirds
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Black Orchid from Orchid
Larkspur Flower from Larkspur
Anethum graveolens or Dill from Herb
Common Buttercup Flower from Buttercup
Rhododendron Calendulaceum or Flame Azalea from Azalea
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Hemerocallis Spp or Day Lily from Perennial
Europeana Floribunda Rose from Roses
Flower Poppy from Red
Caterpillar and Buttefly from Caterpillar
Orchids from Orchid
American Twinflower from Celebrating wildflowers coloring book
Ladybug from Cartoon animals v coloring book
Realistic Sunflowers from Sunflower
Realistic Ruby Throated Hummingbird from Hummingbirds
Bumblebee from Bumblebee
Ladybug from Cartoon animals viii coloring book
Bumblebee from Simple objects coloring book
Daisy from Simple objects iv coloring book
Hummingbird from Cartoon animals ii coloring book
Bug from Animals
Spring Crocus from Crocus
Chinese Peony from Flowers
Bee from Cartoon animals viii coloring book
Black Raspberry from Celebrating wildflowers coloring book
Heliconia Indica from Heliconia
Hibiscus Flower from Hawaii flower
Butterfly from Cartoon animals vii coloring book
Hibiscus from Realistic flowers
Cherokee Rose from Roses
Common Fruit Bats from Realistic animals coloring book
Masdevallia Coccinea Orchid from Orchid
Saskatoon from Serviceberry
Renanthera Imschootiana Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Hyacinth Flower from Hyacinthus
Rabbit Smelling Tulip from Grass
Butterfly from Cartoon animals coloring book
Ladybug from Cartoon animals coloring book
Heliconia Psittacorum from Heliconia
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Aster or Star Plant from Asters
Cornflower, Blue Bottle from Cornflowers
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Burke's Larkspur from Celebrating wildflowers coloring book
Butterfly Flies On A Flower from Flowers
Ranunculus Acris from Buttercup
Bluebell Bellflower from Bellflower
Scarlet Carnation from Carnation
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Common Evening Primrose or Evening Star from Primrose
Tropical Vanda Tricolor Orchid from Orchid
Grasshopper in Garden from Grasshoppers
Cornflower from Cornflowers
Grasshopper on Flower from Grasshoppers
Aster 1 from Asters
Sophronitis Cernua Orchid from Orchid
Sundowner Rosa Grandiflora from Roses
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Bug from Cartoon animals coloring book
Wildflower from Plants ii coloring book
Schlumbergera Bloom from Cactus
Aquilegia Truncata Red Columbine from Columbine
Viola Adunca or Pale Mountain Violet from Violet
Oriental poppy from Perennial
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Cirsium Vulgare or Bull Thistle from Thistle
Daffodil Flowers from Daffodil
Clarkia Amoena Farewell to Spring from Godetia
Western Blue Flax from Celebrating wildflowers coloring book
Nettle-leaved Bellflower from Bellflower
Meadow Buttercup, Ranunculus Acris from Buttercup
Anemone flower from Anemone
Horse Chestnut from Chestnut
Cherry Jam Jar from Cherry
Honey Bee from Woodland animals
Watering Can with Flowers from Watering can
Butterflies and Flowers on a Meadow from Summer
Marigold from Beautiful flowers coloring book
Hibiscus from Plants coloring book
201 - 300 of 1,830 Next page
/ 19